Benjamin Redelings

Evolution, Computation, Statistics

Photo of Benjamin Redelings

News

Jul 2017: BAli-Phy 3.0-beta2 released

Jun 2017: Poster at Evolution 2017 Meeting in Portland, OR
"Faster Likelihoods for Sparse Alignments"

Mar 2017: OpenTree manuscript accepted in PeerJ
"A supertree pipeline for summarizing phylogenetic and taxonomic information for millions of species" [Web]

Jun 2016: Presentation at Evolution 2016 meeting in Austin, TX
"New methods for constructing the supertree of life"

Research

I use mathematics and computational techniques to answer questions in evolutionary genetics. The mathematics is mostly Bayesian inference and stochastic process modeling. The computation is primarily Markov chain Monte Carlo (MCMC). The evolutionary genetics is focused on phylogenetics and multiple sequence alignment, but also includes some coalescent theory.

Work

As of Sep 2015, I'm doing a remote postdoc with Mark Holder on the Open Tree of Life project, part time. I'm also working with Greg Wray at Duke on malaria genomics and PacBio DNA sequencing, part time, as of Feb 2016.

Phylogenetic Alignment

I develop the MCMC software BAli-Phy for inferring highly-accurate multiple sequence alignments (MSA). BAli-Phy performs inference under a phylogenetic model, and so it places insertions and deletions on specific branches of the evolutionary tree instead of just placing gaps in a matrix. BAli-Phy also co-estimates the evolutionary tree along with the alignment.

uncertain                                          certain
....310.......320.......330.......340.......350.......360.......370.......
Thermotoga DEVEIIGLSYEIKKTV---VTSVEMFRKELDEGIAGDNVGCLLRGIDKDEVERGQVLA-----APGSIKPHKRF
Anacystis ETIEIVGLR-DTRSTT---VTGVEMFQKTLDEGLAGDNVGLLLRGIQKTDIERGMVLA-----KPGSITPHTKF
Escheria EEVEIVGIK-ETQKST---CTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLA-----KPGTIKPHTKF
Pyrococcus EVVIFEPASTIFHKPIQGEVKSIEMHHEPLEEALPGDNIGFNVRGVSKNDIKRGDVAGHTTN-PPTVVRTKDTF
Halobacterium DNVSFQPSDVG------GEVKTIEMHHEEVPNAEPGDNVGFNVRGIGKDDIRRGDVCGPADD-PPSVA---DTF
Methanococcus DKVVFEPAGAI------GEIKTVEMHHEQLPSAEPGDNIGFNVRGVGKKDIKRGDVLGHTTN-PPTVA---TDF
Aeropyrum DKVVFMPPGVV------GEVRSIEMHYQQLQQAEPGDNIGFAVRGVSKSDIKRGDVAGHLDK-PPTVA---EEF
Sulfolobus DKIVFMPVGKI------GEVRSIETHHTKIDKAEPGDNIGFNVRGVEKKDVKRGDVAGSVQN-PPTVA---DEF
Giardia MKVVFAPTSQV------SEVKSVEMHHEELKKAGPGDNVGFNVRGLAVKDLKKGYVVGDVTNDPPVGC---KSF
Homo MVVTFAPVNVT------TEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEA---AGF
Euglena DVVTFAPNNLT------TEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKDIRRGYVASNAKNDPAKEA---ADF
Nicotiana MVVTFGPTGLT------TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGA---ASF